Holtsville, NY Dentist - Holtsville Family Dental Services - General Dentist
Holtsville dentist, Holtsville Family Dental Services is a local, trusted dental practice offering general and cosmetic dentistry, teeth whitening, implants, veneers & other dental care. Call today to make an appointment!
holtsvillefamilydentalservices.com is not currently ranked anywhere. holtsvillefamilydentalservices.com was launched at July 25, 2016 and is 8 years and 117 days. It reaches roughly 30 users and delivers about 30 pageviews each month. Its estimated monthly revenue is $0.00. We estimate the value of holtsvillefamilydentalservices.com to be around $10.00. The domain holtsvillefamilydentalservices.com uses a Commercial suffix and its server(s) are located in with the IP number 104.27.171.23. holtsvillefamilydentalservices.com is not listed on Dmoz.
Webmaster and SEO Tools
SEO Tools > Keyword Density Check
CloseWorth & Traffic Estimate of holtsvillefamilydentalservices.com
Estimated numbers for holtsvillefamilydentalservices.com - Niche: General - Average CPM: $2.80 CPM or eCPM: Effective Cost per 1000 impressions.For publishers it means average earnings for each 1k impressions.
Example: A website with a $3 CPM and 10000 impressions/pageviews a day is making on average $30 dollars a day.
Daily
Monthly
Yearly
Website Worth: $10.00
Daily Pageviews: 1
Daily Visitors: 1
Daily Ads Revenue: $0.00
Daily Pageviews: 1
Daily Visitors: 1
Daily Ads Revenue: $0.00
Website Worth: $10.00
Monthly Pageviews: 30
Monthly Visitors: 30
Monthly Ads Revenue: $0.00
Monthly Pageviews: 30
Monthly Visitors: 30
Monthly Ads Revenue: $0.00
Website Worth: $10.00
Yearly Pageviews: 365
Yearly Visitors: 365
Yearly Ads Revenue: $0.00
Yearly Pageviews: 365
Yearly Visitors: 365
Yearly Ads Revenue: $0.00
Choose a specific category/niche The value and earnings of a website just like a physical company also depends on the market it's focusing.
A Humor blog for example usually have low value for potential advertisers while a Finance one have a higher value since it usually has more visitors willing to buy expensive services/products and this consequently affects a website average earnings per visitors so as market worth.
A Humor blog for example usually have low value for potential advertisers while a Finance one have a higher value since it usually has more visitors willing to buy expensive services/products and this consequently affects a website average earnings per visitors so as market worth.
Automobile
$4.30
Average High priced niches
$8.00
Average Low priced niches
$2.00
B2B
$8.00
Banking and Finance
$12.00
Books & Online content
$2.00
Consumer durables
$3.00
Dating
$3.50
Education
$9.00
Entertainment
$1.00
Fashion and Clothing
$1.50
Fitness
$6.00
Food
$4.00
Gaming
$1.50
General
$2.80
Hotels and Travel
$3.50
IT hardware
$6.00
Jobs
$2.50
Legal
$15.00
Machinery or equipment
$3.00
Medical treatment
$8.00
Medicines
$4.00
Miracle drugs or vitamins
$3.50
Music
$1.00
News Portals
$10.00
Random blogs or content
$1.00
Real Estate
$7.20
Religion
$1.70
Science
$4.50
Shopping Portals
$2.50
Social networks
$0.70
Sports
$2.00
Technology
$8.50
Webmaster & Web Hosting
$12.00
Main Information of holtsvillefamilydentalservices.com
- Information of holtsvillefamilydentalservices.com
- Alexa Rank:Not ranked The Alexa rank is a measure of holtsvillefamilydentalservices.com's popularity.
The lower the rank is, the more popular the website is. This rank is calculated using a combination of average daily visitors and pageviews from holtsvillefamilydentalservices.com over the last 3 months.
Google.com ranks #1 for example. - Quantcast Rank:Not ranked/Not available The Quantcast rank is a measure of holtsvillefamilydentalservices.com's popularity.
The lower the rank is, the more popular the website is. This rank is calculated using a combination of average daily visitors and pageviews from holtsvillefamilydentalservices.com over the last 3 months.
Google.com ranks #1 for example. - Google Pagerank:Not ranked/Not available Google PageRank reflects the importance of web pages by considering more than 500 million variables and 2 billion terms. Pages that Google search engine believes are important receive a higher PageRank and are more likely to appear at the top of the search results.
PageRank also considers the importance of each page that casts a vote, as votes from some pages are considered to have greater value, thereby giving the linked page a greater value. - IP Address:104.27.171.23 IP Addresses are similar to physical addresses. It's a number that represents the identification and location of a website. Every computer has an IP address. - IP Tracing
- Site Age:8 years and 117 days
- Created:2016-07-25
- Expires:2019-07-25
- Updated:2017-07-19
- Owner:Unknown
- ICANN Registrar:Register.com, Inc. This shows the company who handled the registration of this domain.
- Hosted in:Unknown Region
- Domain Suffix:Commercial A domain suffix is the last part of a domain name and is often referred to as a "top-level domain" or TLD.
.COM is the most popular and it represents Commercial websites.
DNS Records of holtsvillefamilydentalservices.com
Host | Type | TTL | Extra |
---|---|---|---|
holtsvillefamilydentalservices.com | A | 300 | IP: 104.27.170.23 |
holtsvillefamilydentalservices.com | A | 300 | IP: 104.27.171.23 |
holtsvillefamilydentalservices.com | NS | 86400 | Target: graham.ns.cloudflare.com |
holtsvillefamilydentalservices.com | NS | 86400 | Target: june.ns.cloudflare.com |
holtsvillefamilydentalservices.com | SOA | 3600 | MNAME: graham.ns.cloudflare.com RNAME: dns.cloudflare.com Serial: 2029154050 Refresh: 10000 Retry: 2400 Expire: 604800 Minimum TTL: 3600 |
holtsvillefamilydentalservices.com | MX | 300 | Priority: 10 Target: mx.officite.net |
holtsvillefamilydentalservices.com | AAAA | 300 | IPV6: 2606:4700:30::681b:ab17 |
holtsvillefamilydentalservices.com | AAAA | 300 | IPV6: 2606:4700:30::681b:aa17 |
Name Servers of holtsvillefamilydentalservices.com
graham.ns.cloudflare.com
june.ns.cloudflare.com
Header Info of holtsvillefamilydentalservices.com
holtsvillefamilydentalservices.com is using cloudflare as server.
This website also uses compressing module Gzip to load pages faster.
Header | HTTP1.1 200 OK |
Date | Wed, 22 May 2019 184517 GMT |
Content-Type | texthtml; charset=utf-8 |
Transfer-Encoding | chunked |
Connection | keep-alive |
Set-Cookie | __cfduid=dfed66e3b74867a53289dcadbfc2f01731558550717; expires=Thu, 21-May-20 184517 GMT; path=; domain=.holtsvillefamilydentalservices.com; HttpOnly; Secure Set-Cookie symfony=529efe177ba3e42250931c025f3d49f3; path= |
Expires | Thu, 19 Nov 1981 085200 GMT |
Cache-Control | no-store, no-cache, must-revalidate |
Pragma | no-cache |
X-Ua-Compatible | IE=edge |
Vary | Accept-Encoding |
Expect-CT | max-age=604800, report-uri="report-uri.cloudflare.comcdn-cgibeaconexpect-ct" |
Server | cloudflare |
CF-RAY | 4db0f23f2ea3cec4-IAD |
Content-Encoding | gzip |
Search Engine & Internet Presense of holtsvillefamilydentalservices.com
A website with a large amount of indexed pages in search engines is more likely to have tons of visits.If you are buying holtsvillefamilydentalservices.com or it is your competitor checking how many pages indexed it has is vital.
If holtsvillefamilydentalservices.com has no pages indexed it means it's too new, is banned or suffered a penalty.
- Internet Presense of holtsvillefamilydentalservices.com
- Backlinks: Not available for this website.
- Google Indexed Pages:View This represents how many pages from holtsvillefamilydentalservices.com are currently visible to the public on Google search engine.
- Yahoo Indexed Pages:View This represents how many pages from holtsvillefamilydentalservices.com are currently visible to the public on Yahoo search engine.
- Bing Indexed Pages:View This represents how many pages from holtsvillefamilydentalservices.com are currently visible to the public on Bing search engine.
- Dmoz Listing:No
- Dmoz Title:None
- Dmoz Description:None
- Web Archive:holtsvillefamilydentalservices.com (in the past).
Useful links for Website Owners
This website seems not to be very popular. If you are the owner of it these links might help you to promote it and increase its presense on the internet.Submit it to Google - Submit it to Bing/Yahoo
Statistical Graphics of holtsvillefamilydentalservices.com
Select an option below to analyse several graphic statistics.Compare this website to:
Period:
IP Tracing of holtsvillefamilydentalservices.com
- Country:Not available
- City:Not available
- Region:Not available
- Latitude:Not available
- Longitude:Not available
- ASNum:Not available
- ISP:Not available
- Organization:Not available
Similar Domain Names of holtsvillefamilydentalservices.com
holtsvilefamilydentalservices.com, boltsvillefamilydentalservices.com, goltsvillefamilydentalservices.com, toltsvillefamilydentalservices.com, yoltsvillefamilydentalservices.com, uoltsvillefamilydentalservices.com, joltsvillefamilydentalservices.com, moltsvillefamilydentalservices.com, noltsvillefamilydentalservices.com, hiltsvillefamilydentalservices.com, hkltsvillefamilydentalservices.com, hlltsvillefamilydentalservices.com, hpltsvillefamilydentalservices.com, hoptsvillefamilydentalservices.com, hootsvillefamilydentalservices.com, hoitsvillefamilydentalservices.com, hoktsvillefamilydentalservices.com, homtsvillefamilydentalservices.com, holrsvillefamilydentalservices.com, holfsvillefamilydentalservices.com, holgsvillefamilydentalservices.com, holhsvillefamilydentalservices.com, holysvillefamilydentalservices.com, holtqvillefamilydentalservices.com, holtwvillefamilydentalservices.com, holtevillefamilydentalservices.com, holtzvillefamilydentalservices.com, holtxvillefamilydentalservices.com, holtcvillefamilydentalservices.com, holtsillefamilydentalservices.com, holtscillefamilydentalservices.com, holtsdillefamilydentalservices.com, holtsfillefamilydentalservices.com, holtsgillefamilydentalservices.com, holtsbillefamilydentalservices.com, holtsvullefamilydentalservices.com, holtsvjllefamilydentalservices.com, holtsvkllefamilydentalservices.com, holtsvlllefamilydentalservices.com, holtsvollefamilydentalservices.com, holtsviplefamilydentalservices.com, holtsviolefamilydentalservices.com, holtsviilefamilydentalservices.com, holtsviklefamilydentalservices.com, holtsvimlefamilydentalservices.com, holtsvilpefamilydentalservices.com, holtsviloefamilydentalservices.com, holtsviliefamilydentalservices.com, holtsvilkefamilydentalservices.com, holtsvilmefamilydentalservices.com, holtsvillwfamilydentalservices.com, holtsvillsfamilydentalservices.com, holtsvilldfamilydentalservices.com, holtsvillffamilydentalservices.com, holtsvillrfamilydentalservices.com, holtsvillecamilydentalservices.com, holtsvilledamilydentalservices.com, holtsvilleeamilydentalservices.com, holtsvilleramilydentalservices.com, holtsvilletamilydentalservices.com, holtsvillegamilydentalservices.com, holtsvillebamilydentalservices.com, holtsvillevamilydentalservices.com, holtsvillefqmilydentalservices.com, holtsvillefwmilydentalservices.com, holtsvillefzmilydentalservices.com, holtsvillefxmilydentalservices.com, holtsvillefanilydentalservices.com, holtsvillefahilydentalservices.com, holtsvillefajilydentalservices.com, holtsvillefakilydentalservices.com, holtsvillefalilydentalservices.com, holtsvillefamulydentalservices.com, holtsvillefamjlydentalservices.com, holtsvillefamklydentalservices.com, holtsvillefamllydentalservices.com, holtsvillefamolydentalservices.com, holtsvillefamipydentalservices.com, holtsvillefamioydentalservices.com, holtsvillefamiiydentalservices.com, holtsvillefamikydentalservices.com, holtsvillefamimydentalservices.com, holtsvillefamiltdentalservices.com, holtsvillefamilgdentalservices.com, holtsvillefamilhdentalservices.com, holtsvillefamiljdentalservices.com, holtsvillefamiludentalservices.com, holtsvillefamilyxentalservices.com, holtsvillefamilysentalservices.com, holtsvillefamilywentalservices.com, holtsvillefamilyeentalservices.com, holtsvillefamilyrentalservices.com, holtsvillefamilyfentalservices.com, holtsvillefamilyventalservices.com, holtsvillefamilycentalservices.com, holtsvillefamilydwntalservices.com, holtsvillefamilydsntalservices.com, holtsvillefamilyddntalservices.com, holtsvillefamilydfntalservices.com, holtsvillefamilydrntalservices.com, holtsvillefamilydebtalservices.com, holtsvillefamilydegtalservices.com, holtsvillefamilydehtalservices.com, holtsvillefamilydejtalservices.com, holtsvillefamilydemtalservices.com, holtsvillefamilydenralservices.com, holtsvillefamilydenfalservices.com, holtsvillefamilydengalservices.com, holtsvillefamilydenhalservices.com, holtsvillefamilydenyalservices.com, holtsvillefamilydentqlservices.com, holtsvillefamilydentwlservices.com, holtsvillefamilydentzlservices.com, holtsvillefamilydentxlservices.com, holtsvillefamilydentapservices.com, holtsvillefamilydentaoservices.com, holtsvillefamilydentaiservices.com, holtsvillefamilydentakservices.com, holtsvillefamilydentamservices.com, holtsvillefamilydentalqervices.com, holtsvillefamilydentalwervices.com, holtsvillefamilydentaleervices.com, holtsvillefamilydentalzervices.com, holtsvillefamilydentalxervices.com, holtsvillefamilydentalcervices.com, holtsvillefamilydentalswrvices.com, holtsvillefamilydentalssrvices.com, holtsvillefamilydentalsdrvices.com, holtsvillefamilydentalsfrvices.com, holtsvillefamilydentalsrrvices.com, holtsvillefamilydentalseevices.com, holtsvillefamilydentalsedvices.com, holtsvillefamilydentalsefvices.com, holtsvillefamilydentalsegvices.com, holtsvillefamilydentalsetvices.com, holtsvillefamilydentalserices.com, holtsvillefamilydentalsercices.com, holtsvillefamilydentalserdices.com, holtsvillefamilydentalserfices.com, holtsvillefamilydentalsergices.com, holtsvillefamilydentalserbices.com, holtsvillefamilydentalservuces.com, holtsvillefamilydentalservjces.com, holtsvillefamilydentalservkces.com, holtsvillefamilydentalservlces.com, holtsvillefamilydentalservoces.com, holtsvillefamilydentalservixes.com, holtsvillefamilydentalservises.com, holtsvillefamilydentalservides.com, holtsvillefamilydentalservifes.com, holtsvillefamilydentalservives.com, holtsvillefamilydentalservicws.com, holtsvillefamilydentalservicss.com, holtsvillefamilydentalservicds.com, holtsvillefamilydentalservicfs.com, holtsvillefamilydentalservicrs.com, holtsvillefamilydentalserviceq.com, holtsvillefamilydentalservicew.com, holtsvillefamilydentalservicee.com, holtsvillefamilydentalservicez.com, holtsvillefamilydentalservicex.com, holtsvillefamilydentalservicec.com,Whois Record of holtsvillefamilydentalservices.com
Domain Name: HOLTSVILLEFAMILYDENTALSERVICES.COM
Registry Domain ID: 2046157337_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.register.com
Registrar URL: http://www.register.com
Updated Date: 2017-07-19T05:03:13Z
Creation Date: 2016-07-25T18:20:48Z
Registry Expiry Date: 2019-07-25T18:20:48Z
Registrar: Register.com, Inc.
Registrar IANA ID: 9
Registrar Abuse Contact Email: [Spam Protected Email]
Registrar Abuse Contact Phone: +1.8003337680
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: GRAHAM.NS.CLOUDFLARE.COM
Name Server: JUNE.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-05-22T18:45:08Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
Registry Domain ID: 2046157337_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.register.com
Registrar URL: http://www.register.com
Updated Date: 2017-07-19T05:03:13Z
Creation Date: 2016-07-25T18:20:48Z
Registry Expiry Date: 2019-07-25T18:20:48Z
Registrar: Register.com, Inc.
Registrar IANA ID: 9
Registrar Abuse Contact Email: [Spam Protected Email]
Registrar Abuse Contact Phone: +1.8003337680
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: GRAHAM.NS.CLOUDFLARE.COM
Name Server: JUNE.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-05-22T18:45:08Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.